DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cbx5

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001073653.1 Gene:cbx5 / 563396 ZFINID:ZDB-GENE-030131-5553 Length:204 Species:Danio rerio


Alignment Length:205 Identity:95/205 - (46%)
Similarity:134/205 - (65%) Gaps:10/205 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQD 65
            ||||..|.|..   ..|..:||||.|||::||||.||:|||:|||||:.|..||||||.||||.:
Zfish     1 MGKKSQNREDD---EAASSDEEEYVVEKVLDRRVVKGRVEYFLKWKGFTEKHNTWEPEKNLDCPE 62

  Fly    66 LIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDA 130
            ||.::..:.|  :.::||.....|||......:.:.||.:|:.||||:.|....|.:|.|:   .
Zfish    63 LISEFMKTYK--KGNSASPPSSKSSSTGPSSARPKDSSGSSSTSKRKNSEEENGSSSKPKK---K 122

  Fly   131 EQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYE 195
            ::|.|.|  :.||:||||.|||:||:|:.|.|.||:::|..|:|::|.:..||.|.|::||.|||
Zfish   123 KEDEILV--ARGFERGLEPEKIIGATDSCGDLMFLMKWKDSDEADLVLAKEANHKCPQIVIAFYE 185

  Fly   196 ERLSWYSDNE 205
            |||:|:.|.:
Zfish   186 ERLTWHEDGD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 31/47 (66%)
ChSh 141..202 CDD:197638 33/60 (55%)
cbx5NP_001073653.1 Chromo 21..69 CDD:306815 31/47 (66%)
Chromo_shadow 138..190 CDD:307518 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4056
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.