Sequence 1: | NP_476755.1 | Gene: | Su(var)205 / 34119 | FlyBaseID: | FBgn0003607 | Length: | 206 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017853.1 | Gene: | cbx7a / 550551 | ZFINID: | ZDB-GENE-050417-400 | Length: | 393 | Species: | Danio rerio |
Alignment Length: | 257 | Identity: | 60/257 - (23%) |
---|---|---|---|
Similarity: | 95/257 - (36%) | Gaps: | 97/257 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 EEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKK 85
Fly 86 -------------------------DRPSSSAKAKETQGRASSSTSTASKRK------------- 112
Fly 113 -----------------SEEP------------TAPSGNKSKR-----------TTDAEQDTIPV 137
Fly 138 SG---STGFDRGLEAE-KILGASDNNGRLTFLIQFK---------GVDQAEMVPSSVANEKI 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Su(var)205 | NP_476755.1 | CHROMO | 24..72 | CDD:237991 | 22/47 (47%) |
ChSh | 141..202 | CDD:197638 | 11/56 (20%) | ||
cbx7a | NP_001017853.1 | CHROMO | 10..62 | CDD:214605 | 23/52 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1628171at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000191 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.920 |