DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cbx7a

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001017853.1 Gene:cbx7a / 550551 ZFINID:ZDB-GENE-050417-400 Length:393 Species:Danio rerio


Alignment Length:257 Identity:60/257 - (23%)
Similarity:95/257 - (36%) Gaps:97/257 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKK 85
            |:.:|||.|..:|:|||.|||.|||:|:....:|||||:|:....|:..:| .:.:::::.|.||
Zfish     8 EQVFAVESITKKRIRKGNVEYLLKWQGWSPKYSTWEPEDNILDPRLVLAFE-EKAEKDRALAYKK 71

  Fly    86 -------------------------DRPSSSAKAKETQGRASSSTSTASKRK------------- 112
                                     |:||...:...|:   |.||.....|:             
Zfish    72 KGLRPRQVILRNIYPMDLRSAHKVPDKPSPRIRLSLTR---SMSTEVDQNRRRYRDSVVYRRLKN 133

  Fly   113 -----------------SEEP------------TAPSGNKSKR-----------TTDAEQDTIPV 137
                             |::|            .|.:.::.||           ||...|| || 
Zfish   134 RYKNRQCRSRLFEGIKPSKQPMRHPLPAKDCTENAWNEDEQKRKVKKMRKDEENTTQVHQD-IP- 196

  Fly   138 SG---STGFDRGLEAE-KILGASDNNGRLTFLIQFK---------GVDQAEMVPSSVANEKI 186
            ||   |.|::...|.| :|....|.|....|..:.|         |..::..:..:..||.:
Zfish   197 SGQEMSEGYNSSAEQESEITIKEDENCSSIFDQEEKPSEDTGTAIGAPESSTITDTEKNEPV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 22/47 (47%)
ChSh 141..202 CDD:197638 11/56 (20%)
cbx7aNP_001017853.1 CHROMO 10..62 CDD:214605 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.