Sequence 1: | NP_476755.1 | Gene: | Su(var)205 / 34119 | FlyBaseID: | FBgn0003607 | Length: | 206 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001016617.1 | Gene: | cbx6 / 549371 | XenbaseID: | XB-GENE-951161 | Length: | 361 | Species: | Xenopus tropicalis |
Alignment Length: | 204 | Identity: | 49/204 - (24%) |
---|---|---|---|
Similarity: | 81/204 - (39%) | Gaps: | 51/204 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 EEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKK 85
Fly 86 -DRPSSSAKAKETQGRA-------------SS------STSTASKRKSE---------------E 115
Fly 116 PTAPSGNKS--KRTTDAEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVP 178
Fly 179 SSVANEKIP 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Su(var)205 | NP_476755.1 | CHROMO | 24..72 | CDD:237991 | 22/47 (47%) |
ChSh | 141..202 | CDD:197638 | 8/47 (17%) | ||
cbx6 | NP_001016617.1 | CD_Cbx6 | 8..65 | CDD:349295 | 24/56 (43%) |
CBX7_C | 320..351 | CDD:375056 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1628171at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |