DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and suv39h2

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001016508.1 Gene:suv39h2 / 549262 XenbaseID:XB-GENE-852675 Length:406 Species:Xenopus tropicalis


Alignment Length:131 Identity:40/131 - (30%)
Similarity:64/131 - (48%) Gaps:28/131 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQY-----------EASRKDE 77
            |.||.:.|.|:.||..::::||||:||:.|||||..||.|..|::|:           :.::|..
 Frog    43 YEVEYLCDYRIEKGVEKFFVKWKGWPESCNTWEPTRNLKCPTLLKQFYSDLYNYFCALKPNKKGF 107

  Fly    78 EKSAASKKDRPSSS----AKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVS 138
            .|::....| ||.|    .|||:         ..|.:|..||   .:..|:...|...::|:.:.
 Frog   108 LKNSIKSLD-PSLSDYIVKKAKQ---------RIALRRWEEE---LNRKKTHSGTLFVENTVDLE 159

  Fly   139 G 139
            |
 Frog   160 G 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 23/58 (40%)
ChSh 141..202 CDD:197638
suv39h2NP_001016508.1 CHROMO 43..90 CDD:214605 23/46 (50%)
Pre-SET 152..238 CDD:282838 2/9 (22%)
SET 246..369 CDD:214614
S-adenosyl-L-methionine binding. /evidence=ECO:0000250 257..259
S-adenosyl-L-methionine binding. /evidence=ECO:0000250 326..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.