DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and Cbx4

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_008766707.2 Gene:Cbx4 / 501403 RGDID:1587243 Length:551 Species:Rattus norvegicus


Alignment Length:108 Identity:36/108 - (33%)
Similarity:53/108 - (49%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENN-LDCQDLIQQYEASRKDEEKSAASK 84
            |..:|||.|..:|:|||:|||.:||:|:....||||||.| ||.:.||......|:::......:
  Rat     8 EHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKR 72

  Fly    85 KDRPSSSAKAKETQGRASS------STSTASKRKSEEPTAPSG 121
            ..:|........|..|.|:      .:|..::.|.|..|...|
  Rat    73 GPKPKPLVVQVPTFARRSNVLTGLQDSSADNRAKLELGTQGKG 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 25/48 (52%)
ChSh 141..202 CDD:197638
Cbx4XP_008766707.2 CD_Cbx4 8..62 CDD:349292 26/53 (49%)
CBX7_C <529..550 CDD:407338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.