DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and rhi

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_536794.1 Gene:rhi / 44879 FlyBaseID:FBgn0004400 Length:418 Species:Drosophila melanogaster


Alignment Length:150 Identity:45/150 - (30%)
Similarity:67/150 - (44%) Gaps:20/150 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEP-ENNLDCQ 64
            |.:....|......:...:..|||.||||:.:|...|:.:..:||.|:|...||||| ||..:|.
  Fly     1 MSRNHQRPNLGLVDAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCM 65

  Fly    65 DLIQQYEAS-----RKDEEKSAASKKDRPSSS---------AKAKETQGRASS--STSTASKRKS 113
            .|:..:|:.     ||...||....|..||||         :.:|:||..:.|  :.:||...|.
  Fly    66 KLVSDFESEVFRLHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKM 130

  Fly   114 EEPTAPSGNKSKRTTDAEQD 133
            .:   ..|...|:|....:|
  Fly   131 NQ---KKGKNIKKTAGKIKD 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 20/48 (42%)
ChSh 141..202 CDD:197638
rhiNP_536794.1 CHROMO 22..72 CDD:237991 22/49 (45%)
ChSh 357..411 CDD:294039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.