DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and HP1c

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster


Alignment Length:185 Identity:60/185 - (32%)
Similarity:100/185 - (54%) Gaps:49/185 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EEEEEYAVEKIIDRRV-RKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAA 82
            :.|..:.||:|:|:|: .:||||||:||:||...:||||||.|.||.:|||::|.||        
  Fly     3 KNEPNFVVERIMDKRITSEGKVEYYIKWRGYTSADNTWEPEENCDCPNLIQKFEESR-------- 59

  Fly    83 SKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTGFDRGL 147
                     ||:|              ||..::|......|.:                |::|||
  Fly    60 ---------AKSK--------------KRGEKKPKCEEIQKLR----------------GYERGL 85

  Fly   148 EAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYEERLSWYS 202
            |..:|:||:|..|.:.:|::::..|:.::|||:...||.|:|:|.:: ::::.||
  Fly    86 ELAEIVGATDVTGDIKYLVRWQFCDEFDLVPSAQIVEKDPQMLIDYF-QKMAPYS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 27/48 (56%)
ChSh 141..202 CDD:197638 20/60 (33%)
HP1cNP_651093.1 Chromo 9..58 CDD:278797 28/48 (58%)
Chromo_shadow 89..134 CDD:279701 15/45 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455521
Domainoid 1 1.000 61 1.000 Domainoid score I3809
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I3624
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114392at33392
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - mtm4828
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
109.900

Return to query results.
Submit another query.