DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and HP1e

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_649878.1 Gene:HP1e / 41108 FlyBaseID:FBgn0037675 Length:174 Species:Drosophila melanogaster


Alignment Length:204 Identity:62/204 - (30%)
Similarity:98/204 - (48%) Gaps:41/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKIDNPESSAKVSDAE---EEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLD 62
            |....|..|:.:..|:..   ||.|||.||:|:|||...|:::|.:||..|.:.:||||...:||
  Fly     1 MDSDADGGETVSNFSENSTDFEETEEYIVERILDRRHYMGQLQYLVKWLDYSDEDNTWESAADLD 65

  Fly    63 CQDLIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRT 127
            |..||...|                   |.|:.:.....::...|.:||...:|..        .
  Fly    66 CHSLIDSIE-------------------SQKSLKRGQELNNQYETKAKRLKIDPCL--------V 103

  Fly   128 TDAEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIH 192
            .|:.           |:.|..|::||..:.|||.::|||:|..:||.::|||.:|..:||:||:.
  Fly   104 VDSP-----------FNHGFTAQEILKGAKNNGEISFLIRFWHLDQPQVVPSGIAYVEIPQMVLK 157

  Fly   193 FYEERLSWY 201
            |||...:::
  Fly   158 FYENHCNFH 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 21/47 (45%)
ChSh 141..202 CDD:197638 25/61 (41%)
HP1eNP_649878.1 CHROMO 25..67 CDD:237991 20/41 (49%)
Chromo_shadow 113..164 CDD:279701 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114392at33392
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.