| Sequence 1: | NP_476755.1 | Gene: | Su(var)205 / 34119 | FlyBaseID: | FBgn0003607 | Length: | 206 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001387975.1 | Gene: | Cbx6 / 315136 | RGDID: | 1307314 | Length: | 414 | Species: | Rattus norvegicus |
| Alignment Length: | 140 | Identity: | 38/140 - (27%) |
|---|---|---|---|
| Similarity: | 56/140 - (40%) | Gaps: | 34/140 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 21 EEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKK 85
Fly 86 D--------------------------RPSSSAKAKETQGRAS--------SSTSTASKRKSEEP 116
Fly 117 TAPSGNKSKR 126 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Su(var)205 | NP_476755.1 | CD_HP1a_insect | 24..72 | CDD:349300 | 23/47 (49%) |
| CSD_HP1a_insect | 146..198 | CDD:349305 | |||
| Cbx6 | NP_001387975.1 | CD_Cbx6 | 8..65 | CDD:349295 | 25/56 (45%) |
| CBX7_C | 359..390 | CDD:465385 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||