DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and Cdyl2

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_017456726.1 Gene:Cdyl2 / 292044 RGDID:1309548 Length:551 Species:Rattus norvegicus


Alignment Length:198 Identity:57/198 - (28%)
Similarity:87/198 - (43%) Gaps:50/198 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VEKIIDRRV-RKGKVEYYLKWKGYPETENTWEPENN-LDCQDLIQQYEASRKDEEKSAASKKD-- 86
            ||:|:|:|. :|||.||.::||||..||:|||||:: |.|::.|.::......::|...|.|.  
  Rat    57 VERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHLPKDKKVKSGKQAG 121

  Fly    87 ------------------RPSSSAKAKET---QGRASSSTSTASKRKS-EEPTAPSGNKSKRTTD 129
                              ||....|:|.|   :.|.:|..|.:.|..| :.|...:...|.|||.
  Rat   122 ASKLLRDARSLPVERLSHRPLEPGKSKSTSHKRKRVNSPLSRSKKGSSGKAPDRATKTVSYRTTP 186

  Fly   130 AEQDTIPV--------SGSTG-------FDRG-----LEAEKILG---ASDNNGRLTFLIQFKGV 171
            :....:|:        :|..|       |..|     ||....||   .||.:|..:.|:: .|:
  Rat   187 SGLQIMPLKKAQNGLENGDAGSEKDESHFGNGSHQPDLELNDQLGEQETSDCDGTHSALVE-NGI 250

  Fly   172 DQA 174
            ..|
  Rat   251 GSA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 24/47 (51%)
ChSh 141..202 CDD:197638 13/49 (27%)
Cdyl2XP_017456726.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.