DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and chp1

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_593666.1 Gene:chp1 / 2542239 PomBaseID:SPAC18G6.02c Length:960 Species:Schizosaccharomyces pombe


Alignment Length:205 Identity:51/205 - (24%)
Similarity:89/205 - (43%) Gaps:35/205 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SDAEEEEEEYAVEKIIDRRVRKGKV-EYYLKWKGYPETENTWEPENNL-DCQDLIQQYEASRK-- 75
            ::.|.:.:.|.||.|:..||.|..: |||:||.||...:||||||.|| ..:.::::::..:|  
pombe    13 NEGETDADVYEVEDILADRVNKNGINEYYIKWAGYDWYDNTWEPEQNLFGAEKVLKKWKKRKKLI 77

  Fly    76 --------DEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKR-----T 127
                    |.|.:.|.|..|.....: ::.|.|.|..|..:.|.|  |.......|..|     .
pombe    78 AKGLLEPFDAEDNEAKKMKREKEILR-QQRQKRKSELTQLSQKVK--EKFKKMRKKPARRIVTIA 139

  Fly   128 TDAEQDTIPVSGSTGFDR-GLEAE-KILGASDNNGRLT-------------FLIQFKGVDQAEMV 177
            .|.|::.........|:| .::.| |....:|....|:             :|.::..|..:.::
pombe   140 NDEEEEDDQTMDEDAFERKSMQGELKERNLTDKTSTLSTSFGETSPDVNPFYLSEWPTVTDSILL 204

  Fly   178 PSSVANEKIP 187
            ..|::::.||
pombe   205 SKSLSSDAIP 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 22/49 (45%)
ChSh 141..202 CDD:197638 11/62 (18%)
chp1NP_593666.1 CHROMO 21..>64 CDD:214605 22/42 (52%)
RRM 224..>371 CDD:223796
RRM_SF 313..373 CDD:240668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I3374
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.