DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and chp2

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_596808.1 Gene:chp2 / 2540047 PomBaseID:SPBC16C6.10 Length:380 Species:Schizosaccharomyces pombe


Alignment Length:230 Identity:59/230 - (25%)
Similarity:100/230 - (43%) Gaps:61/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SDAEEEEEEYAVEKIIDRRVRK--GKVEYYLKWKGYPE-TENTWEPENN-LDCQDLIQQYEASRK 75
            |:.:..:||:|||.|:|.|::|  ...:|||||:||.: ::|||..|.: ..|.:||..|..|| 
pombe   167 SEDKNSDEEFAVEMILDSRMKKDGSGFQYYLKWEGYDDPSDNTWNDEEDCAGCLELIDAYWESR- 230

  Fly    76 DEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAP---------SGNKSKRTTD-A 130
                     ..:|..|:..:.|:.||.||...:...|.|...:.         |.|.:.|.|| .
pombe   231 ---------GGKPDLSSLIRLTRSRARSSNEASYVEKDESSNSDDSISYKRRRSRNAANRITDYV 286

  Fly   131 EQDTIPVSGSTGFDRGLEAEKILGASD----------------------------NNGRLTFLIQ 167
            :.|   :|.|:..::..:.||.: .||                            :||:|...|:
pombe   287 DSD---LSESSMKEKQSKIEKYM-KSDKSSKNFKPPFQKKSWEDLVDCVKTVQQLDNGKLIAKIK 347

  Fly   168 FKG--VDQAEMVPSSVANEKIPRMVIHFYEERLSW 200
            :|.  |...:.:   :.::|.|..:|.:||..:.:
pombe   348 WKNGYVSTHDNI---IIHQKCPLKIIEYYEAHIKF 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 22/51 (43%)
ChSh 141..202 CDD:197638 15/90 (17%)
chp2NP_596808.1 CHROMO 174..228 CDD:237991 24/53 (45%)
ChSh 316..380 CDD:197638 11/67 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.870

Return to query results.
Submit another query.