DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and CBX7

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_783640.1 Gene:CBX7 / 23492 HGNCID:1557 Length:251 Species:Homo sapiens


Alignment Length:109 Identity:41/109 - (37%)
Similarity:57/109 - (52%) Gaps:8/109 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKK 85
            |:.:|||.|..:|||||||||.:||||:|...:|||||.::....|:..||   :.||:..||..
Human     8 EQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYE---EKEERDRASGY 69

  Fly    86 DRPSSSAKAKETQGRASSSTSTASKRKSEEP-----TAPSGNKS 124
            .:.....|....|...|....::.|.|.:|.     |.|.|:.|
Human    70 RKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGS 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 25/47 (53%)
ChSh 141..202 CDD:197638
CBX7NP_783640.1 CD_Cbx7 7..62 CDD:349293 27/56 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..220
CBX7_C 209..240 CDD:407338
Required for cellular lifespan extension 223..236
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S3980
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.