Sequence 1: | NP_476755.1 | Gene: | Su(var)205 / 34119 | FlyBaseID: | FBgn0003607 | Length: | 206 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055107.3 | Gene: | CBX6 / 23466 | HGNCID: | 1556 | Length: | 412 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 48/207 - (23%) |
---|---|---|---|
Similarity: | 79/207 - (38%) | Gaps: | 51/207 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 EEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKK 85
Fly 86 D--------------------------RPSSSAKAKETQGRAS--------SSTSTASKRKSEEP 116
Fly 117 TAPSGNKSKRTTDAEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQ------AE 175
Fly 176 MVPSSVANEKIP 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Su(var)205 | NP_476755.1 | CHROMO | 24..72 | CDD:237991 | 23/47 (49%) |
ChSh | 141..202 | CDD:197638 | 9/53 (17%) | ||
CBX6 | NP_055107.3 | CHROMO | 10..62 | CDD:214605 | 24/51 (47%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 127..152 | 6/32 (19%) | |||
DNA_pol3_gamma3 | <237..>331 | CDD:331207 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 243..364 | ||||
CBX7_C | 357..388 | CDD:319236 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1628171at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |