DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and hpl-1

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_510199.1 Gene:hpl-1 / 181450 WormBaseID:WBGene00001995 Length:184 Species:Caenorhabditis elegans


Alignment Length:190 Identity:59/190 - (31%)
Similarity:90/190 - (47%) Gaps:50/190 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEAS 73
            |||:.|         :.|||::::|:.:|..|||:||:|:||:|.:|||..||.|..:||:|   
 Worm    31 ESSSNV---------FVVEKVLNKRLTRGGSEYYIKWQGFPESECSWEPIENLQCDRMIQEY--- 83

  Fly    74 RKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVS 138
                ||.||.:                     :|..:|.|.:|:..|..:.:.:|..|.     :
 Worm    84 ----EKEAAKR---------------------TTRKRRYSPQPSTSSSAELQPSTSDEW-----A 118

  Fly   139 GSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYEERL 198
            |.|       .:.|:|.:...|.|.||.:|.. |...::|...||.:.|..||.|||.||
 Worm   119 GKT-------LKTIIGITKAPGELHFLCKFSD-DSVHLIPLREANVRFPSQVIKFYETRL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 23/47 (49%)
ChSh 141..202 CDD:197638 20/58 (34%)
hpl-1NP_510199.1 CD_HP1_like 36..85 CDD:349316 24/64 (38%)
ChSh 114..174 CDD:197638 22/70 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161952
Domainoid 1 1.000 66 1.000 Domainoid score I6523
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I3624
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 1 1.000 - - mtm4828
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.