DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cec-4

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_501231.1 Gene:cec-4 / 177536 WormBaseID:WBGene00017990 Length:270 Species:Caenorhabditis elegans


Alignment Length:162 Identity:47/162 - (29%)
Similarity:70/162 - (43%) Gaps:29/162 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKKIDNPESSAKVSD-------------AEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPE--- 50
            ||.|...|...|..|             :::...|||||:::..|..||...|.::|||||.   
 Worm    52 GKTITATEFDFKGDDSLLSTYKKKVTKQSDDSSGEYAVERVLAHRKVKGSPLYLVQWKGYPHPVW 116

  Fly    51 TENTWEPENNLD-CQDLIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSE 114
            ....|  |.:|| |:||:..|:..::| .|.|.:.|..||.:.| |..:.....:.:.:...:..
 Worm   117 NSEMW--EEDLDNCKDLLAAYKKHQED-LKIAQTPKKTPSKTPK-KTPKSLKRRALTPSDDEEEA 177

  Fly   115 EPTAP--------SGNKSKRTTDAEQDTIPVS 138
            .|.||        |..|.||||..|.:.:..|
 Worm   178 GPIAPEPKKTPKQSTKKLKRTTSPETNLVEKS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 21/51 (41%)
ChSh 141..202 CDD:197638
cec-4NP_501231.1 CHROMO 86..140 CDD:214605 22/55 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54478
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.