DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cec-6

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_500828.1 Gene:cec-6 / 177338 WormBaseID:WBGene00020463 Length:891 Species:Caenorhabditis elegans


Alignment Length:168 Identity:46/168 - (27%)
Similarity:67/168 - (39%) Gaps:49/168 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLD-CQDLIQ-------- 68
            |..:||.:....:||  .|:| |..|..|.:.|:||...|.|||||.||: |::|.:        
 Worm    26 KALNAEAKFSPASVE--YDKR-RHSKYAYLVHWRGYDWKERTWEPEENLENCEELQKFKERNNMS 87

  Fly    69 --------QYE---------ASRK------------DEEKSAASKKDRPSSSAKAKETQGRASSS 104
                    .||         ||.|            .|||.|..|......:.|.:.....||:.
 Worm    88 LDHLTFEHHYEHSTWRRISLASEKCVTNRYLKTDDEIEEKRARKKAKLEEQNRKEQAKNPHASAE 152

  Fly   105 TSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTG 142
            |..|.|:|..|..   |::..:.:|.|.     :|::|
 Worm   153 TEPAVKKKKIEGV---GSRIPKISDREG-----AGTSG 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 22/73 (30%)
ChSh 141..202 CDD:197638 1/2 (50%)
cec-6NP_500828.1 Mating_C 123..>278 CDD:372279 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.