DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cec-1

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_498862.1 Gene:cec-1 / 176190 WormBaseID:WBGene00000414 Length:304 Species:Caenorhabditis elegans


Alignment Length:141 Identity:51/141 - (36%)
Similarity:76/141 - (53%) Gaps:16/141 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQY---EASRKDE-----E 78
            |.|.||.|::.|.:|||.|:|:||.||..|.|:|||:.|:....||:.:   ||:||.|     :
 Worm     6 ELYTVESILEHRKKKGKSEFYIKWLGYDHTHNSWEPKENIVDPTLIEAFFTREAARKAEIKAKKD 70

  Fly    79 KSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGS--- 140
            |.||.||   .:|:||..:..:||:||.....:.:.:| .|..:..||...|..|..|.|.:   
 Worm    71 KMAAGKK---GASSKASASVSKASASTPARGAKAAPKP-PPKKSPPKRQRLAGGDIRPDSDTDEE 131

  Fly   141 -TGFDRGLEAE 150
             :..|:..:||
 Worm   132 HSSADKKSKAE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 22/50 (44%)
ChSh 141..202 CDD:197638 3/10 (30%)
cec-1NP_498862.1 CHROMO 8..59 CDD:214605 22/50 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.