DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cec-8

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_497198.1 Gene:cec-8 / 175202 WormBaseID:WBGene00021913 Length:679 Species:Caenorhabditis elegans


Alignment Length:202 Identity:53/202 - (26%)
Similarity:81/202 - (40%) Gaps:65/202 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ESSAKVSDAEEE-EEEYAVEKIIDRRVRKGKVE---YYLKWKGYPE-TENT--W--EPENNLDCQ 64
            |...||::.|:: .:||.||||:..|....::.   |.:.|:|:|: ..||  |  |.||   ||
 Worm    98 EYKFKVTELEDDGSKEYVVEKIVAHRYPNDRLNQPLYLVMWRGFPDPVSNTEMWGEELEN---CQ 159

  Fly    65 DLIQQY-----------------------------EASRKDEEKS----------AASKKDRPSS 90
            :|:..|                             |.|..:||||          |||..|..|.
 Worm   160 ELLDAYNEEHDIDLSKTVMNKPPKKSKHQDTSDDSEESEDEEEKSPRKRSSKKRRAASVSDSDSD 224

  Fly    91 S-----------AKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTGFD 144
            |           .|||.::...||...:..:|:.::  :....|||:...:|:....|:.|:..|
 Worm   225 SDSDFDKKKWKKNKAKRSKRDDSSDDDSEMERRRKK--SKKSKKSKKFKKSEKRKRAVNDSSSDD 287

  Fly   145 RGLEAEK 151
            .. |.||
 Worm   288 ED-EEEK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 20/84 (24%)
ChSh 141..202 CDD:197638 4/11 (36%)
cec-8NP_497198.1 CD_CEC-4_like 114..167 CDD:349317 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.