DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cec-3

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_495652.1 Gene:cec-3 / 174265 WormBaseID:WBGene00011636 Length:339 Species:Caenorhabditis elegans


Alignment Length:224 Identity:52/224 - (23%)
Similarity:93/224 - (41%) Gaps:39/224 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNL-DC-Q 64
            |.:.::.|..|:..   :.:|.:.||||:..:|....:...::|.||...|:|||||.:| :| .
 Worm     5 GSREESREPEAREG---KSDEIFEVEKILAHKVTDNLLVLQVRWLGYGADEDTWEPEEDLQECAS 66

  Fly    65 DLIQQY-------------EASRKDEEKSAASKKDRPSSSAKAKETQGRASSS-----TSTASKR 111
            :::.:|             |..:|..:|:.:.|..:.|.:....|:...:..|     ||..||:
 Worm    67 EVVAEYYKKLKVTDKTELIELLQKQIKKNKSQKSKKRSKTVSDHESNHDSDGSYGTPKTSKKSKK 131

  Fly   112 KSEEPTAPSGNKSKRTTDAE----QDTI--PVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKG 170
            .::..|..|....|..|.|.    :.|:  ||:.:......:|.        .:.|..:|.:...
 Worm   132 SAKNETPVSSKVPKVPTKAALKSYEATVSGPVAPNNAKKAAMEV--------RDTRRNWLDEESS 188

  Fly   171 VDQAEMVPSSVANEKIPR--MVIHFYEER 197
            .|:||........|||..  .|:...||:
 Worm   189 DDEAETTAPLSDVEKIASKVKVVKAVEEK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 17/62 (27%)
ChSh 141..202 CDD:197638 12/59 (20%)
cec-3NP_495652.1 Chromo 25..75 CDD:278797 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.