DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and W05F2.8

DIOPT Version :10

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001249353.1 Gene:W05F2.8 / 13179739 WormBaseID:WBGene00195045 Length:132 Species:Caenorhabditis elegans


Alignment Length:49 Identity:12/49 - (24%)
Similarity:25/49 - (51%) Gaps:5/49 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDL-IQQYEASRKDEEK 79
            :|:.:||.:..:   |..:.::.| ||.....:.| .:::|..|:.|.|
 Worm     6 KRISEGKKKRLI---GEDDADDEW-PEMPPGHRILTTEEHEMQRRKESK 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CD_HP1a_insect 24..72 CDD:349300 8/40 (20%)
CSD_HP1a_insect 146..198 CDD:349305
W05F2.8NP_001249353.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.