powered by:
Protein Alignment Su(var)205 and W05F2.8
DIOPT Version :9
Sequence 1: | NP_476755.1 |
Gene: | Su(var)205 / 34119 |
FlyBaseID: | FBgn0003607 |
Length: | 206 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001249353.1 |
Gene: | W05F2.8 / 13179739 |
WormBaseID: | WBGene00195045 |
Length: | 132 |
Species: | Caenorhabditis elegans |
Alignment Length: | 49 |
Identity: | 12/49 - (24%) |
Similarity: | 25/49 - (51%) |
Gaps: | 5/49 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 RRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDL-IQQYEASRKDEEK 79
:|:.:||.:..: |..:.::.| ||.....:.| .:::|..|:.|.|
Worm 6 KRISEGKKKRLI---GEDDADDEW-PEMPPGHRILTTEEHEMQRRKESK 50
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Su(var)205 | NP_476755.1 |
CHROMO |
24..72 |
CDD:237991 |
8/40 (20%) |
ChSh |
141..202 |
CDD:197638 |
|
W05F2.8 | NP_001249353.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1911 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.