DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and Cdyl

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_034011.1 Gene:Cdyl / 12593 MGIID:1339956 Length:593 Species:Mus musculus


Alignment Length:185 Identity:50/185 - (27%)
Similarity:86/185 - (46%) Gaps:42/185 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ESSAKVSDAEEEEEEYAVEKIIDRRV-RKGKVEYYLKWKGYPETENTWEPENNL-DCQDLIQQYE 71
            ::|..:.|||.:     ||.|:|:|. :|||.||.::||||...::|||||.:| :|::.|..:.
Mouse    46 QASPAIQDAETQ-----VESIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFN 105

  Fly    72 ASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTST---------------------ASKRKSEE 115
            ....:.:|..:..:...:|.:.|::...|::.||.:                     |:.:|..:
Mouse   106 RRHNERQKEGSLARASRASPSNARKQISRSTHSTLSKTNSKALVVGKDHESKSSQLLAASQKFRK 170

  Fly   116 PTAPSGNKSKRTTDAEQDTI-------PVSGSTGFD--RGLEAEKI----LGASD 157
            ..||| ..:::..|..:..|       ||.|.|..|  :|...||:    .||.|
Mouse   171 NPAPS-LANRKNMDLAKSGIKILVPKSPVKGRTSVDGFQGESPEKLDPVDQGAED 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 22/49 (45%)
ChSh 141..202 CDD:197638 8/23 (35%)
CdylNP_034011.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
CHROMO 55..109 CDD:214605 23/58 (40%)
Interaction with EZH2. /evidence=ECO:0000250|UniProtKB:Q9Y232 56..304 46/175 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..158 6/47 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..223 7/22 (32%)
crotonase-like 339..535 CDD:119339
Acetyl-CoA-binding domain. /evidence=ECO:0000255 357..589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.