DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and Cbx5

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001070257.1 Gene:Cbx5 / 12419 MGIID:109372 Length:191 Species:Mus musculus


Alignment Length:206 Identity:87/206 - (42%)
Similarity:120/206 - (58%) Gaps:26/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQD 65
            ||||......|:    :.|:||||.|||::|||:.||:|||.|||||:.|..||||||.||||.:
Mouse     1 MGKKTKRTADSS----SSEDEEEYVVEKVLDRRMVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPE 61

  Fly    66 LIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDA 130
            ||.::....|                 |.||.:.......|..:||||....:....|||:..:.
Mouse    62 LISEFMKKYK-----------------KMKEGENNKPREKSEGNKRKSSFSNSADDIKSKKKREQ 109

  Fly   131 EQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYE 195
            ..|.     :.||:||||.|||:||:|:.|.|.||:::|..|:|::|.:..||.|.|::||.|||
Mouse   110 SNDI-----ARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYE 169

  Fly   196 ERLSWYSDNED 206
            |||:|::..||
Mouse   170 ERLTWHAYPED 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 30/47 (64%)
ChSh 141..202 CDD:197638 33/60 (55%)
Cbx5NP_001070257.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 9/23 (39%)
CD_HP1alpha_Cbx5 19..68 CDD:349298 31/48 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..117 13/68 (19%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302 31/56 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8761
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22812
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.