DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and Cbx4

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_031651.2 Gene:Cbx4 / 12418 MGIID:1195985 Length:551 Species:Mus musculus


Alignment Length:108 Identity:36/108 - (33%)
Similarity:53/108 - (49%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENN-LDCQDLIQQYEASRKDEEKSAASK 84
            |..:|||.|..:|:|||:|||.:||:|:....||||||.| ||.:.||......|:::......:
Mouse     8 EHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQLMGYRKR 72

  Fly    85 KDRPSSSAKAKETQGRASS------STSTASKRKSEEPTAPSG 121
            ..:|........|..|.|:      .:|..::.|.|..|...|
Mouse    73 GPKPKPLVVQVPTFARRSNVLTGLQDSSADNRAKLELGTQGKG 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 25/48 (52%)
ChSh 141..202 CDD:197638
Cbx4NP_031651.2 CHROMO 10..62 CDD:214605 25/51 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 125..152
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..193
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..244
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..399
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 430..451
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.