DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and Cbx3

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001341931.1 Gene:Cbx3 / 12417 MGIID:108515 Length:183 Species:Mus musculus


Alignment Length:206 Identity:88/206 - (42%)
Similarity:123/206 - (59%) Gaps:36/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQD 65
            ||||.:.  .|.||.:|  |.||:.|||::||||..|||||:|||||:.:.:||||||.||||.:
Mouse    11 MGKKQNG--KSKKVEEA--EPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPE 71

  Fly    66 LIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDA 130
            ||:.:..|:|     |..:||                     .:||||...:....:|||:..||
Mouse    72 LIEAFLNSQK-----AGKEKD---------------------GTKRKSLSDSESDDSKSKKKRDA 110

  Fly   131 EQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYE 195
                  .....||.|||:.|:|:||:|::|.|.||:::|..|:|::|.:..||.|.|::||.|||
Mouse   111 ------ADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYE 169

  Fly   196 ERLSWYSDNED 206
            |||:|:|..||
Mouse   170 ERLTWHSCPED 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 29/47 (62%)
ChSh 141..202 CDD:197638 31/60 (52%)
Cbx3NP_001341931.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 9/20 (45%)
CD_HP1gamma_Cbx3 29..78 CDD:349299 30/48 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 78..125 19/78 (24%)
CSD_HP1gamma_Cbx3 116..173 CDD:349303 29/56 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.