DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and Cbx1

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001349489.1 Gene:Cbx1 / 12412 MGIID:105369 Length:185 Species:Mus musculus


Alignment Length:208 Identity:94/208 - (45%)
Similarity:127/208 - (61%) Gaps:33/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKIDNPESSAKVSDA-EEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQ 64
            ||||    ::..||.:. |||||||.|||::||||.||||||.|||||:.:.:||||||.||||.
Mouse     1 MGKK----QNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCP 61

  Fly    65 DLIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTD 129
            |||.::..|:|                 .|.||      ..|...|||::..:...|.:||....
Mouse    62 DLIAEFLQSQK-----------------TAHET------DKSEGGKRKADSDSEDKGEESKPKKK 103

  Fly   130 AEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFY 194
            .|:...|    .||.||||.|:|:||:|::|.|.||:::|..|:|::||:..||.|.|::||.||
Mouse   104 KEESEKP----RGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFY 164

  Fly   195 EERLSWYS-DNED 206
            ||||:|:| .:||
Mouse   165 EERLTWHSYPSED 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 32/47 (68%)
ChSh 141..202 CDD:197638 33/60 (55%)
Cbx1NP_001349489.1 CD_HP1beta_Cbx1 20..69 CDD:349297 33/48 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 24/87 (28%)
CSD_HP1beta_Cbx1 112..169 CDD:349301 31/56 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850554
Domainoid 1 1.000 78 1.000 Domainoid score I8761
eggNOG 1 0.900 - - E1_KOG1911
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22812
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10651
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.