DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and chd3

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_002940874.3 Gene:chd3 / 100216299 XenbaseID:XB-GENE-1008908 Length:2036 Species:Xenopus tropicalis


Alignment Length:55 Identity:15/55 - (27%)
Similarity:29/55 - (52%) Gaps:8/55 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AKVSDAEEEEEEY-------AVEKIIDRRV-RKGKVEYYLKWKGYPETENTWEPE 58
            |:.||.||....|       ::::||:..: ::|...|.:||:.....::|||.:
 Frog   631 AEYSDLEERFYRYGIKPEWMSIQRIINHSLDKRGNYHYLVKWRDLSYDQSTWEED 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 10/43 (23%)
ChSh 141..202 CDD:197638
chd3XP_002940874.3 CHDNT 197..250 CDD:400425
PHD1_CHD_II 403..445 CDD:277006
PHD2_CHD_II 479..521 CDD:277007
CD1_tandem_CHD3-4_like 526..604 CDD:349314
CD2_tandem_CHD3-4_like 647..701 CDD:349309 9/39 (23%)
PLN03142 738..>1293 CDD:215601
DEXHc_CHD3 755..986 CDD:350813
DUF1087 1327..1377 CDD:399459
DUF1086 1398..1537 CDD:368921
PspC_subgroup_2 <1535..1750 CDD:411408
CHDCT2 1780..1906 CDD:400426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.