DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and mphosph8

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_002938003.1 Gene:mphosph8 / 100145122 XenbaseID:XB-GENE-968247 Length:847 Species:Xenopus tropicalis


Alignment Length:172 Identity:48/172 - (27%)
Similarity:83/172 - (48%) Gaps:30/172 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ESSAKV----SDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNL-DCQDLIQ 68
            :.:||.    |:.|:|::.:.||.|:|.::..|:|.|.::||||....:|||||.:| ||::::.
 Frog    28 DGTAKAETVESEQEDEDDVFEVESILDSKIEGGEVLYRVRWKGYDSEGDTWEPEAHLDDCKEVLL 92

  Fly    69 QYEASRKDEEKSAASKKDRPSS--------SAKAKETQGRASSSTSTASKRKSEEPTAPSGN--- 122
            ::. .::.|.|....||:.|..        .|.::..|......:....|:||:|......|   
 Frog    93 EFR-RKQAENKPKPVKKEMPQQKLSPSDLFEADSESEQSDQKVDSPPKKKKKSKEEDEELANEEM 156

  Fly   123 --------KSKRTTDAEQDTIPVSGSTGFDRGLEAEKILGAS 156
                    |||..:.||.:   :|.|:..|  |:.:|.|..|
 Frog   157 KKKKSKSGKSKEKSKAEAE---LSDSSSPD--LKPKKRLSES 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 19/48 (40%)
ChSh 141..202 CDD:197638 5/16 (31%)
mphosph8XP_002938003.1 CD_MMP8 46..96 CDD:349283 19/50 (38%)
ANKYR 483..683 CDD:223738
ANK repeat 553..583 CDD:293786
ANK repeat 585..616 CDD:293786
Ank_2 591..680 CDD:372319
ANK repeat 618..649 CDD:293786
PTZ00322 620..>748 CDD:140343
ANK repeat 651..680 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.