DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Su(var)205 and cbx3

DIOPT Version :9

Sequence 1:NP_476755.1 Gene:Su(var)205 / 34119 FlyBaseID:FBgn0003607 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_017949990.2 Gene:cbx3 / 100038121 XenbaseID:XB-GENE-492315 Length:227 Species:Xenopus tropicalis


Alignment Length:206 Identity:88/206 - (42%)
Similarity:126/206 - (61%) Gaps:35/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQD 65
            ||||.:.  ...||.:|  |.||:.|||::||||..|||||||||||:.:::||||||.||||.:
 Frog    54 MGKKQNG--KGKKVEEA--EPEEFVVEKVLDRRVVNGKVEYYLKWKGFTDSDNTWEPEENLDCPE 114

  Fly    66 LIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDA 130
            ||:.:..|:|       :.|::|.|                  :||||...:....:|||:..:.
 Frog   115 LIEAFLNSQK-------AGKEKPDS------------------NKRKSVSDSESEDSKSKKKRET 154

  Fly   131 EQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYE 195
                  |....||.|||:.|:|:||:|::|.|.||:::|..|:|::||:..||.|.|::||.|||
 Frog   155 ------VDKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVPAKEANVKCPQVVIAFYE 213

  Fly   196 ERLSWYSDNED 206
            |||:|:|..||
 Frog   214 ERLTWHSCPED 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Su(var)205NP_476755.1 CHROMO 24..72 CDD:237991 30/47 (64%)
ChSh 141..202 CDD:197638 32/60 (53%)
cbx3XP_017949990.2 CD_HP1gamma_Cbx3 72..121 CDD:349299 31/48 (65%)
CSD_HP1beta_Cbx1 160..217 CDD:349301 30/56 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628171at2759
OrthoFinder 1 1.000 - - FOG0000191
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X422
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.