DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8419 and AT4G01350

DIOPT Version :9

Sequence 1:NP_609193.1 Gene:CG8419 / 34118 FlyBaseID:FBgn0031999 Length:921 Species:Drosophila melanogaster
Sequence 2:NP_192044.2 Gene:AT4G01350 / 828015 AraportID:AT4G01350 Length:652 Species:Arabidopsis thaliana


Alignment Length:233 Identity:53/233 - (22%)
Similarity:87/233 - (37%) Gaps:38/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 CIRCHTCNYPTDLSLGGVRQLPQ-NYLLVRRIEVLRLQAGEDVISRVWCSLCTEEISA-TYHCIS 487
            |..|.||.:..||:.......|. .:.|.....::.|:..|:.:|   |.||.:.|:. :|.|:.
plant    93 CYSCSTCEFKVDLTCAMKPSPPAIEHPLCHHHSLVFLKKREEKVS---CELCKDSIAGPSYSCLE 154

  Fly   488 CT----LNLCTLCKEAHERQRSTASHRMRSILELRRARKQKQQQMGLGDSSKLVLRCGIHTNFEL 548
            |.    :|...|.||.:....|  :|.::.|          ..:....|:....|.||......:
plant   155 CDVYFHVNCIQLSKEVNHPCHS--AHPLKLI----------PFESLTDDAETTCLLCGKKPAENM 207

  Fly   549 KAFCTNCRQLACTDC------LVILH-KGHRHETISRAIGHQGKLLKEATDQTRPLCQYAEHSIE 606
            ...|:.|...:|..|      |||.| |.|:|..|...     :.:....|.....|::|.:...
plant   208 LYHCSVCNFTSCLGCTKNPPLLVIEHIKTHKHPLILFP-----RRIPCICDICGKKCEFAVYVCP 267

  Fly   607 RLNAI-ARGINDRCDDIQTQVERYMQQYMDALTVHRKT 643
            :.:.: |||    |.|:...:......:...||.|..|
plant   268 QCDFVTARG----CIDLARVININRHDHRIYLTHHLGT 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8419NP_609193.1 RING 308..>334 CDD:214546
zf-B_box 537..576 CDD:279037 14/45 (31%)
iSH2_PI3K_IA_R 583..703 CDD:304922 12/62 (19%)
Filamin 748..846 CDD:279024
IG_FLMN 751..849 CDD:214720
AT4G01350NP_192044.2 C1_3 391..420 CDD:284959
C1_2 551..581 CDD:281148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.