DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8419 and trim2b

DIOPT Version :9

Sequence 1:NP_609193.1 Gene:CG8419 / 34118 FlyBaseID:FBgn0031999 Length:921 Species:Drosophila melanogaster
Sequence 2:XP_009304581.1 Gene:trim2b / 558046 ZFINID:ZDB-GENE-090312-70 Length:669 Species:Danio rerio


Alignment Length:316 Identity:69/316 - (21%)
Similarity:125/316 - (39%) Gaps:10/316 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 GDSSKLVLRCGIHTNFELKAFCTNCRQLACTDCLVILHKGHRHETISRAIGHQGKLLKEATDQTR 595
            |..:.|:  |..|.......:|..|....|.||:...|..|..:::.:|:..|...|::..|..:
Zfish    23 GKGTALI--CSQHKGKVSALYCLVCENAVCEDCMNGEHAEHPTDSLEKAVDQQLAALQDKVDSAK 85

  Fly   596 PLCQYAEHSIERLNAIARGINDRCDDIQTQVERYMQQYMDALTVHRKTLLQQISRARESKVEVVL 660
            ........:::.|..|.:.:|.:...|:..:.....:....|...:..||.::......| :.||
Zfish    86 NRLPQIREAVQYLREILQQLNSQRSSIEEDIHSSFSELHKTLDTRKSVLLMELEVTYGLK-QKVL 149

  Fly   661 KQQLDLEKRTQQAMD-AVRFSQELCEIGADVEILSYVTILLRRLEYCQQFKPPVDPKISDSLHFL 724
            :.|||...:.:.|:: ....:.|..:.|:...:|........||........|:.|:.:|.|..:
Zfish   150 QAQLDTLLQEESAINYNCSLTSEALDGGSKASVLQAHKEAGERLGDLSSQGLPLQPEENDQLDLM 214

  Fly   725 PKIRAPSTKDQRDIPLYGIITMQVVEPSLCTLEWEGFSQLRLHKKADLLLHSRDADGVSLCHGGL 789
            .:|...    ::.|...|.|.......|......:|..|..:.:.|.:::.:||..| .||..|.
Zfish   215 MEIEGL----RKSIHNLGTIVTTNAVASQTEASGDGLEQCIVGQPASVIITTRDKAG-GLCKTGN 274

  Fly   790 EINCMLKYKDSSSKFLPVEVSDNRDGTYNISFTPDAQGTLILTITINDRPIKGGPF 845
            .|.....|....| ....|:.|.::|||...:|...:|...|.:.:.|:.|||.||
Zfish   275 AIISAEVYTPDGS-IADGEIVDMKNGTYEFQYTVKKEGNFSLALRLYDQHIKGSPF 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8419NP_609193.1 RING 308..>334 CDD:214546
zf-B_box 537..576 CDD:279037 9/38 (24%)
iSH2_PI3K_IA_R 583..703 CDD:304922 20/120 (17%)
Filamin 748..846 CDD:279024 27/98 (28%)
IG_FLMN 751..849 CDD:214720 27/95 (28%)
trim2bXP_009304581.1 zf-B_box 29..66 CDD:279037 9/38 (24%)
iSH2_PI3K_IA_R 73..199 CDD:304922 22/126 (17%)
IG_FLMN 237..334 CDD:214720 27/95 (28%)
Filamin 237..329 CDD:279024 25/93 (27%)
NHL_TRIM2_like 396..669 CDD:271330
NHL repeat 414..453 CDD:271330
YncE 415..>660 CDD:225926
NHL repeat 461..500 CDD:271330
NHL repeat 503..540 CDD:271330
NHL repeat 547..588 CDD:271330
NHL repeat 594..636 CDD:271330
NHL repeat 639..665 CDD:271330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.