DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8419 and Rnf208

DIOPT Version :9

Sequence 1:NP_609193.1 Gene:CG8419 / 34118 FlyBaseID:FBgn0031999 Length:921 Species:Drosophila melanogaster
Sequence 2:NP_001102665.1 Gene:Rnf208 / 499748 RGDID:1565957 Length:265 Species:Rattus norvegicus


Alignment Length:150 Identity:43/150 - (28%)
Similarity:66/150 - (44%) Gaps:32/150 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 IKAKEQLHPKRLLSL-KASPELRVSP-PTPDTTQPQVQMP--TQLLLSLT-----PRPEVFDAPS 266
            ::|.:.:||::...| .|:|....:| ||| |..|:...|  |:::::..     |..|......
  Rat    30 MEAMKIVHPEKFPELPAATPCFPPAPRPTP-TLAPKRAWPSDTEIIVNQACGGDMPTLEGASHTP 93

  Fly   267 PLTRSPSRS------PGISP---------PVSPSPSITLRPSTPPENTVIFTDDLKCGICLDVYT 316
            ||.|.|.:.      |.::|         .:.|.|:.:...|:.|   ||..:.|:|..|...|.
  Rat    94 PLPRRPRKGSSELGFPRVAPVDEVIVNQYVIRPGPTASAPSSSGP---VIAGEPLECPTCGHTYN 155

  Fly   317 ----DPRTLHCLHSFCLQCL 332
                .||.|.||||.|.|||
  Rat   156 VTQRRPRVLSCLHSVCEQCL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8419NP_609193.1 RING 308..>334 CDD:214546 13/28 (46%)
zf-B_box 537..576 CDD:279037
iSH2_PI3K_IA_R 583..703 CDD:304922
Filamin 748..846 CDD:279024
IG_FLMN 751..849 CDD:214720
Rnf208NP_001102665.1 RING-HC_RNF208 144..197 CDD:319473 14/31 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.