DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8419 and Trim56

DIOPT Version :9

Sequence 1:NP_609193.1 Gene:CG8419 / 34118 FlyBaseID:FBgn0031999 Length:921 Species:Drosophila melanogaster
Sequence 2:NP_958761.1 Gene:Trim56 / 384309 MGIID:2685298 Length:734 Species:Mus musculus


Alignment Length:493 Identity:99/493 - (20%)
Similarity:167/493 - (33%) Gaps:157/493 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 RPSTPPENTVIFTDDLKCGICLDVYTDPRTLHCLHSFCLQCLVSENFKDESLWDQDQARSEEPSN 355
            :.|:|.....:.:|.|.|.|||:....|:||.|||::|..||.                      
Mouse     4 KDSSPTLLEALSSDFLACKICLEQLHTPKTLPCLHTYCQDCLA---------------------- 46

  Fly   356 YSLRSEMGGSSAELTATVSPARQRGSSFTLRRKKSMDRLVIRSKSDGKRSTSSIGTRFTGSFASE 420
               :.::||.                                                       
Mouse    47 ---QLDIGGQ------------------------------------------------------- 53

  Fly   421 VSTRCIRCHTCNYPTDLSLGGVRQLPQNYLLVRRIEVLRLQAGEDVIS-RVWCSLC------TEE 478
                 :||..|.....:...||.....|:.:...:::::.:|..||.| :..|:||      :..
Mouse    54 -----VRCPECREIVPVPAEGVAAFKTNFFVNGLLDLVKARAPGDVHSGKPTCALCPLVGGKSSG 113

  Fly   479 ISATYHCISCTLNLCTLCKEAHERQRSTASHRMRSILELR------RARKQKQQQMGLGDSSKLV 537
            ..||..|:.|..:||..|.:.|...|.|..||:..::..|      .||:::..|          
Mouse   114 GPATARCLDCADDLCQACADGHRCSRQTHKHRVVDLVGYRAGWYDEEARERQASQ---------- 168

  Fly   538 LRCGIHTNFELKAFCTNCRQLACTDCLVILHKGHRHETISRAIGHQGKLLKE---ATDQTRPLCQ 599
              |..|....|...|..|.||.|.||.:..|..|....::.|:..:...|:|   ..|..  |.:
Mouse   169 --CPQHPGEALCFLCQPCSQLLCKDCRLGPHIDHPCLPLAEAVRSRKPGLEELLAGVDSN--LVE 229

  Fly   600 YAEHSIERLNAIARGINDRCDDIQTQVERYMQQYMDALTVHRKTLLQQISRARESKVEVVLKQQL 664
            .....:....|:|. :.::...:.||||...::.:.:|...::.:|.|:....|:..|...::..
Mouse   230 LEATRVAEKEALAL-LREQAASVGTQVEEAAERILKSLLAQKQEVLGQLRALVEAAEEATRERLT 293

  Fly   665 DLEKRTQQAMDAVRFSQELCEIGADVEILSYVTILLRRLEYCQQFKPPVDPKISDSLHFLPKIRA 729
            .:|::.|.|..|..|::.:..:|.:.||||....:.:||...|.                    |
Mouse   294 KIERQEQVAKAAAAFARRVLSLGLEAEILSLEGAITQRLRQLQD--------------------A 338

  Fly   730 PSTKDQRDIPLYGIITMQVVEPSLCTLEWEGFSQLRLH 767
            |.|..                |:.|.|     .||.||
Mouse   339 PWTSG----------------PTRCVL-----PQLELH 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8419NP_609193.1 RING 308..>334 CDD:214546 13/25 (52%)
zf-B_box 537..576 CDD:279037 12/38 (32%)
iSH2_PI3K_IA_R 583..703 CDD:304922 25/122 (20%)
Filamin 748..846 CDD:279024 7/20 (35%)
IG_FLMN 751..849 CDD:214720 7/17 (41%)
Trim56NP_958761.1 RING_Ubox 19..60 CDD:388418 18/125 (14%)
Bbox1_TRIM56_C-V 99..149 CDD:380868 15/49 (31%)
Bbox_SF 165..209 CDD:381767 13/55 (24%)
SMC_prok_B <205..>336 CDD:274008 28/133 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 372..463
NHL 500..727 CDD:302697
NHL repeat 531..569 CDD:271320
WD40 repeat 540..568 CDD:293791
NHL repeat 577..608 CDD:271320
NHL repeat 616..653 CDD:271320
WD40 repeat 660..699 CDD:293791
NHL repeat 660..693 CDD:271320
NHL repeat 702..727 CDD:271320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.