DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8419 and tn

DIOPT Version :9

Sequence 1:NP_609193.1 Gene:CG8419 / 34118 FlyBaseID:FBgn0031999 Length:921 Species:Drosophila melanogaster
Sequence 2:NP_001137707.1 Gene:tn / 37190 FlyBaseID:FBgn0265356 Length:1517 Species:Drosophila melanogaster


Alignment Length:561 Identity:108/561 - (19%)
Similarity:166/561 - (29%) Gaps:236/561 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 FTDDLKCGICLDVYTDPRTLHCLHSFCLQ-CLVSENFKDESLWDQDQARSEEPSNYSLRSEMGGS 365
            |...|.|.:|||.|..|:.|.|.||||:: |:       |.|.|.                    
  Fly     4 FEQLLTCCVCLDRYRIPKLLPCQHSFCMEPCM-------EGLVDY-------------------- 41

  Fly   366 SAELTATVSPARQRGSSFTLRRKKSMDRLVIRSKSDGKRSTSSIGTRFTGSFASEVSTRCIRCHT 430
                               :||:                                     ::|..
  Fly    42 -------------------VRRQ-------------------------------------VKCPE 50

  Fly   431 CNYPTDLSLGGVRQLPQNYLLVRRIEVLRLQAGE-------DVISRVWCSLCTEEISATYHCISC 488
            |.....:...||:..|.|..|.|.:|:.....||       .::.|  |.:|:|:...: ||..|
  Fly    51 CRAEHRIPYNGVQAFPTNVTLQRFLELHIEITGELPDPTSGQIMER--CGVCSEKAYLS-HCAHC 112

  Fly   489 TLNLCTLCKEAHERQRSTASHRMRSIL--ELRRARKQKQQQMGLGDSSKLVLRCGIHTNFELKAF 551
            ...:|..||.||           ..||  |:.|...|              :|..:|        
  Fly   113 EKKICEDCKSAH-----------MDILRREITRFNSQ--------------IRRSLH-------- 144

  Fly   552 CTNCRQLACTDCLVILHKGHRHETISRAIGHQGKLLKEATDQTRPLCQYAEHSIERLNAIARGIN 616
                   ...|.|.|:.|    .|:|.              ||..: ...|...|....|.:.|.
  Fly   145 -------RLQDSLAIIEK----NTMSL--------------QTNAI-SVTEEIDEIYQRITKAIK 183

  Fly   617 DRCDDIQTQVERYMQQYMDALTVHRKTLLQQISRARESKVEVVLKQQLDLE--KRTQQAMDAVRF 679
            ||.|.::.:::||:...:..||                    .||:.||||  ..|.......::
  Fly   184 DRSDQLKGEIDRYLAVELRNLT--------------------TLKENLDLEITNITSNCDTVDKY 228

  Fly   680 SQELCEIGADVEILSYVTILLRRLEYCQQFKPPVDPKISDSLHFLPKIRAPSTKDQRDIPLYGII 744
            ..|..| ..|.|::....|.|:.:|:.:.|:.. :...|..:.||..|                 
  Fly   229 MNETVE-WDDCELMDTKEIFLKTVEFLRHFEYE-NNDYSRRVRFLVSI----------------- 274

  Fly   745 TMQVVEPSLCTLEWEGFSQLRLHKKADLLLHSRDADG-VSLCH----GGLEINCMLKYKDS--SS 802
                 :|:...:....|..|      ::..||..:.| ||..|    ..|:...|....|.  ::
  Fly   275 -----DPNQLVMNLATFGDL------NIAPHSTPSGGSVSSSHLAPPSALQPGLMRSKSDHRLAT 328

  Fly   803 KFLPVEVSDNRDGTYNISFTPDAQGTLILTITINDRPIKGG 843
            :|   ...:.|.|                   .||.|:.||
  Fly   329 QF---RQQEERSG-------------------YNDEPVLGG 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8419NP_609193.1 RING 308..>334 CDD:214546 13/26 (50%)
zf-B_box 537..576 CDD:279037 6/38 (16%)
iSH2_PI3K_IA_R 583..703 CDD:304922 26/121 (21%)
Filamin 748..846 CDD:279024 20/103 (19%)
IG_FLMN 751..849 CDD:214720 20/100 (20%)
tnNP_001137707.1 RING 9..54 CDD:238093 20/127 (16%)
zf-B_box 94..>122 CDD:279037 9/30 (30%)
iSH2_PI3K_IA_R 131..231 CDD:304922 31/167 (19%)
NHL_TRIM71_like 1234..1517 CDD:271324
YncE 1253..>1517 CDD:225926
NHL repeat 1258..1297 CDD:271324
WD40 repeat 1261..1304 CDD:293791
NHL repeat 1305..1344 CDD:271324
WD40 repeat 1345..1377 CDD:293791
NHL repeat 1352..1388 CDD:271324
NHL repeat 1396..1436 CDD:271324
WD40 repeat 1402..1439 CDD:293791
NHL repeat 1445..1475 CDD:271324
WD40 repeat 1446..1485 CDD:293791
NHL repeat 1491..1517 CDD:271324
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.