DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8419 and trim33l

DIOPT Version :9

Sequence 1:NP_609193.1 Gene:CG8419 / 34118 FlyBaseID:FBgn0031999 Length:921 Species:Drosophila melanogaster
Sequence 2:XP_005158134.1 Gene:trim33l / 327484 ZFINID:ZDB-GENE-030131-5695 Length:1293 Species:Danio rerio


Alignment Length:614 Identity:128/614 - (20%)
Similarity:194/614 - (31%) Gaps:236/614 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 PLTRSPSRSPGISPPVSPSPSITLRPSTPPENTVIFTDDLKCGIC------LDVYTDPRTLHCLH 325
            |..||.|..|.:...|                         ||.|      |:..|:|:.|.|||
Zfish     6 PTGRSASPRPDLQKAV-------------------------CGTCAACKGHLNDSTEPKLLPCLH 45

  Fly   326 SFCLQCLVSENFKDESLWDQDQARSEEPSNYSLRSEMGGSSAELTATVSPARQRGSSFTLRRKKS 390
            :.|..||.                         :....|||.:..:.       ..||.|     
Zfish    46 TVCNTCLT-------------------------KICTDGSSQDCPSC-------AQSFGL----- 73

  Fly   391 MDRLVIRSKSDGKRSTSSIGTRFTGSFASEVSTRCIRCHTCNYPTDLSLGGVRQLPQNYLLVRRI 455
                                        |||:       .|....|||  ...:.|:        
Zfish    74 ----------------------------SEVT-------ECAIFEDLS--DNNKAPK-------- 93

  Fly   456 EVLRLQAGEDVISRVWCSLCTE-EISATYHCISCTLNLCTLCKEAHERQRSTASHRMRSILELRR 519
                            |..|.| |:|.  .|:.|...||..|..||.|.:.|..|.:        
Zfish    94 ----------------CGGCEENEVSG--WCVQCEEALCLDCVTAHHRVKVTRDHEV-------- 132

  Fly   520 ARKQKQQQMGLGDSSKLVLRCGIHTNFELKAFCTNCRQLACTDCLVILHKGHRHETISRAIGHQG 584
              ..|:...|.....    ||.:|:...|:.||..|.:|.|.||.:|.|:||.......|:..|.
Zfish   133 --MPKKPPTGWIQRR----RCPLHSQESLRFFCLVCEELTCKDCQLITHRGHSFVNQEEAVESQK 191

  Fly   585 KLLKEATDQTRPLCQYAEHSIERLNAIARGINDRCDDIQTQVERYMQQYMDALTVHRKTLLQQIS 649
            :.:....|..|.......||:..|.|       |..||         :::..||  :|.|:|.:.
Zfish   192 QQMNSLLDSIRRQKGTISHSLLLLEA-------RLQDI---------EHVKMLT--KKLLIQSVH 238

  Fly   650 RARESKVEVVLKQQLDLEKRTQQAMDAVRFSQELCEIGA----DVEILSYVTILLRRLEYCQQFK 710
            :...|.|                    ::.||.|.:|.|    :|.:|......|.|||.||.: 
Zfish   239 KIYHSMV--------------------LKASQILKDIQAVFAEEVRVLLERKSSLSRLEGCQDY- 282

  Fly   711 PPVDPKISDSLHFLPKIRAPSTKDQRDIPLYGIITMQV---VEPSLCTLEWEGFSQLRLH--KKA 770
                  |:|   |:.||:  .|:....:.....|..||   :....||.|    |.::||  .:.
Zfish   283 ------IAD---FIDKIQ--RTQGHCLLVYKKRIETQVKMLLSRETCTPE----SMIKLHIEIQK 332

  Fly   771 DLLLHSRDADGVSLCHGGLEINCMLKYKDSSSKFL---PVEVSDNRDGTYNISFTPDAQ------ 826
            ||..|..:...|.:...      .:.:....::::   ||.|.         |..|::.      
Zfish   333 DLCQHILNFGFVRITKN------FVPFTSERTQYIQTNPVSVE---------SLNPNSMETATNV 382

  Fly   827 GTLILTITINDRPIKGGPFTFQARQVRPH 855
            |..:.:.::|:: |.|.|.|  :.|..|:
Zfish   383 GHAMASSSVNEQ-IPGDPAT--SSQTAPN 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8419NP_609193.1 RING 308..>334 CDD:214546 13/31 (42%)
zf-B_box 537..576 CDD:279037 15/38 (39%)
iSH2_PI3K_IA_R 583..703 CDD:304922 25/123 (20%)
Filamin 748..846 CDD:279024 21/111 (19%)
IG_FLMN 751..849 CDD:214720 21/108 (19%)
trim33lXP_005158134.1 zf-RING_UBOX 25..65 CDD:290181 14/64 (22%)
BBOX 90..132 CDD:197662 16/67 (24%)
zf-B_box 143..182 CDD:279037 15/42 (36%)
PHD_TIF1_like 1071..1113 CDD:277016
Bromodomain 1133..1228 CDD:295360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.