DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8419 and Trim32

DIOPT Version :9

Sequence 1:NP_609193.1 Gene:CG8419 / 34118 FlyBaseID:FBgn0031999 Length:921 Species:Drosophila melanogaster
Sequence 2:NP_001012103.1 Gene:Trim32 / 313264 RGDID:1305238 Length:655 Species:Rattus norvegicus


Alignment Length:651 Identity:124/651 - (19%)
Similarity:206/651 - (31%) Gaps:201/651 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 LKCGICLDVYTD----PRTLHCLHSFCLQCLVSENFKDESLWDQDQARSEEPSNYSLRSEMGGSS 366
            |:|.||::.:|:    |:.|||.|:.|.|||       |.|               |.|.:.|  
  Rat    19 LECPICMESFTEEQLRPKLLHCGHTICRQCL-------EKL---------------LASSING-- 59

  Fly   367 AELTATVSPARQRGSSFTLRRKKSMDRLVIRSKSDGKRSTSSIGTRFTGSFASEVSTRCIRCHTC 431
                                                                       :||..|
  Rat    60 -----------------------------------------------------------VRCPFC 65

  Fly   432 NYPTDLSLGGVRQLPQNYLLVRRIEVLRLQAGEDVISRVWCSLCTEEISATYHCISCTLNLCTLC 496
            :..|.::  .:.||..|..:::.|:...|   .:.:..:.|..|...:...: |.||.|.||..|
  Rat    66 SKITRIT--SLTQLTDNLTVLKIIDTAGL---SEAVGLLMCRACGRRLPRQF-CRSCGLVLCEPC 124

  Fly   497 ---------------KEAHERQRSTASHRMRSILEL-----RRARKQKQQQMGLGDSSKLVLRCG 541
                           |||.|.:|.....::..:.||     ||....:.....|....|.||:..
  Rat   125 READHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELTGELQRRKAALEGVSRDLQARYKAVLQEY 189

  Fly   542 IHTNFELKAFCTNCRQLACTDCLVILHKGHRHETISRAIGHQGKLLKEATDQTRPLCQYAEHSIE 606
            .|....::......|:. .|..|..:.|.:     |:.:..|..||..|..|....|.|....|:
  Rat   190 GHEERRVQEELARSRKF-FTGSLAEVEKSN-----SQVVEEQSYLLNIAEVQAVSRCDYFLAKIK 248

  Fly   607 RLNAIARGINDRCDDIQTQVERYMQQYMDALTVHRKTLLQQISRARESKVEVVLKQQLDLEKRTQ 671
            :.:...  :.:..|:.:.::         ..::.|:..||.:...:...|..:...|...:.||.
  Rat   249 QADVAL--LEETADEEEPEL---------TASLPRELTLQDVELLKVGHVGPLQIGQAVKKPRTV 302

  Fly   672 QAMD--AVRFSQELCEIGADVEILSYVTILLRRLEYCQQFKPPVDPKISDSLH------------ 722
            ...|  ||       |.||.....:.||  .|.::...:...| .|:.|.:..            
  Rat   303 NMEDSWAV-------EEGAASSASASVT--FREMDMSPEEVVP-SPRASPAKQRSSEAASSIQQC 357

  Fly   723 -FLPKIRAP-STKDQRDIPLYGIITMQVVEPSLCTLEWEGFSQLRLHKKADLLLHSR-------- 777
             ||.|:.|. ||....::|    :::.|...|...:...|..::::..:...|...|        
  Rat   358 LFLKKMGAKGSTPGMFNLP----VSLYVTSQSEVLVADRGNYRIQVFNRKGFLKEIRRSPSGIDS 418

  Fly   778 ------DADGVSLCHGGLEINC--MLKYKDSSSKFLPVEVSDNR---------DGTYNISFTPDA 825
                  .||..:|....:.:||  ::...||....|.|...|..         ...:.|:..|..
  Rat   419 FVLSFLGADLPNLTPLSVAMNCHGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSG 483

  Fly   826 QGTLILTITINDRPIKGGP---FTFQARQVRPHTGIYHCCSFCSGKGNRNVMCSCEGHMPGYSGC 887
            |      ..:.|  ::||.   ||     |....|:......||....:.|.|..||.:....|.
  Rat   484 Q------FVVTD--VEGGKLWCFT-----VDRGAGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGL 535

  Fly   888 G 888
            |
  Rat   536 G 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8419NP_609193.1 RING 308..>334 CDD:214546 13/29 (45%)
zf-B_box 537..576 CDD:279037 7/38 (18%)
iSH2_PI3K_IA_R 583..703 CDD:304922 25/121 (21%)
Filamin 748..846 CDD:279024 21/125 (17%)
IG_FLMN 751..849 CDD:214720 22/125 (18%)
Trim32NP_001012103.1 RING-HC_TRIM32_C-VII 20..66 CDD:319501 20/128 (16%)
Bbox1_TRIM32_C-VII 99..139 CDD:380864 9/40 (23%)
NHL_TRIM32_like 364..646 CDD:271331 37/190 (19%)
NHL repeat 376..416 CDD:271331 6/43 (14%)
NHL repeat 433..472 CDD:271331 7/38 (18%)
NHL repeat 474..514 CDD:271331 10/52 (19%)
NHL repeat 515..566 CDD:271331 6/22 (27%)
NHL repeat 579..611 CDD:271331
NHL repeat 619..645 CDD:271331
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.