DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8419 and TRIM32

DIOPT Version :9

Sequence 1:NP_609193.1 Gene:CG8419 / 34118 FlyBaseID:FBgn0031999 Length:921 Species:Drosophila melanogaster
Sequence 2:NP_001093149.1 Gene:TRIM32 / 22954 HGNCID:16380 Length:653 Species:Homo sapiens


Alignment Length:640 Identity:127/640 - (19%)
Similarity:215/640 - (33%) Gaps:180/640 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 LKCGICLDVYTD----PRTLHCLHSFCLQCLVSENFKDESLWDQDQARSEEPSNYSLRSEMGGSS 366
            |:|.||::.:|:    |:.|||.|:.|.|||       |.|               |.|.:.|  
Human    18 LECPICMESFTEEQLRPKLLHCGHTICRQCL-------EKL---------------LASSING-- 58

  Fly   367 AELTATVSPARQRGSSFTLRRKKSMDRLVIRSKSDGKRSTSSIGTRFTGSFASEVSTRCIRCHTC 431
                                                                       :||..|
Human    59 -----------------------------------------------------------VRCPFC 64

  Fly   432 NYPTDLSLGGVRQLPQNYLLVRRIEVLRLQAGEDVISRVWCSLCTEEISATYHCISCTLNLCTLC 496
            :..|.::  .:.||..|..:::.|:...|   .:.:..:.|..|...:...: |.||.|.||..|
Human    65 SKITRIT--SLTQLTDNLTVLKIIDTAGL---SEAVGLLMCRSCGRRLPRQF-CRSCGLVLCEPC 123

  Fly   497 KE----------------AHERQRSTASH--RMRSIL-ELRRARKQKQQQMG--LGDSSKLVLRC 540
            :|                |.||:|.....  |:|.:: ||:| ||...:.:.  |....|.||:.
Human   124 READHQPPGHCTLPVKEAAEERRRDFGEKLTRLRELMGELQR-RKAALEGVSKDLQARYKAVLQE 187

  Fly   541 GIHTNFELKAFCTNCRQLACTDCLVILHKGHRHETISRAIGHQGKLLKEATDQTRPLCQYAEHSI 605
            ..|....::......|:. .|..|..:.|.:     |:.:..|..||..|..|....|.|....|
Human   188 YGHEERRVQDELARSRKF-FTGSLAEVEKSN-----SQVVEEQSYLLNIAEVQAVSRCDYFLAKI 246

  Fly   606 ERLNAIARGINDRCDDIQTQVERYMQQYMDALTVHRKTLLQ-------QISRARESKVEVVLKQQ 663
            ::.:...  :.:..|:.:.::...:.:   .||:....||:       ||.:|.:....|.::..
Human   247 KQADVAL--LEETADEEEPELTASLPR---ELTLQDVELLKVGHVGPLQIGQAVKKPRTVNVEDS 306

  Fly   664 LDLEKRTQQAMDAVRFSQELCEIGADVEILSYVTILLRRLEYCQQFKPPVDPKISDSLHFLPKIR 728
            ..:|.....|..:|.|        .::::.....:...|....:|..|.....|...| ||.|:.
Human   307 WAMEATASAASTSVTF--------REMDMSPEEVVASPRASPAKQRGPEAASNIQQCL-FLKKMG 362

  Fly   729 AP-STKDQRDIPLYGIITMQ----VVEPS---LCTLEWEGF-SQLRLHKKA--DLLLHSRDADGV 782
            |. ||....::|:...:|.|    |.:..   :.....:|| .::|.....  ..:|....||..
Human   363 AKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLSFLGADLP 427

  Fly   783 SLCHGGLEINC--MLKYKDSSSKFLPVEVSDNR---------DGTYNISFTPDAQGTLILTITIN 836
            :|....:.:||  ::...||....|.|...|..         ...:.|:..|..|      ..:.
Human   428 NLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQ------FVVT 486

  Fly   837 DRPIKGGP---FTFQARQVRPHTGIYHCCSFCSGKGNRNVMCSCEGHMPGYSGCG 888
            |  ::||.   ||     |...:|:......||....:.|.|..||.:....|.|
Human   487 D--VEGGKLWCFT-----VDRGSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLG 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8419NP_609193.1 RING 308..>334 CDD:214546 13/29 (45%)
zf-B_box 537..576 CDD:279037 7/38 (18%)
iSH2_PI3K_IA_R 583..703 CDD:304922 21/126 (17%)
Filamin 748..846 CDD:279024 21/117 (18%)
IG_FLMN 751..849 CDD:214720 22/117 (19%)
TRIM32NP_001093149.1 RING-HC_TRIM32_C-VII 19..65 CDD:319501 20/128 (16%)
Bbox1_TRIM32_C-VII 98..138 CDD:380864 10/40 (25%)
FAM184 <143..224 CDD:406160 20/87 (23%)
NHL 1 358..401 9/42 (21%)
NHL_TRIM32_like 362..644 CDD:271331 39/186 (21%)
NHL 2 415..458 10/42 (24%)
NHL 3 459..499 8/52 (15%)
NHL 4 562..605
NHL 5 606..646
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.