DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8419 and F43C11.8

DIOPT Version :9

Sequence 1:NP_609193.1 Gene:CG8419 / 34118 FlyBaseID:FBgn0031999 Length:921 Species:Drosophila melanogaster
Sequence 2:NP_494244.2 Gene:F43C11.8 / 173590 WormBaseID:WBGene00018385 Length:323 Species:Caenorhabditis elegans


Alignment Length:322 Identity:63/322 - (19%)
Similarity:122/322 - (37%) Gaps:58/322 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 IRCHTCNYPTDLSLGGVRQLPQNYLLVRRIEVLRLQAGEDVISRVWCSLCTEEISATYHCISCTL 490
            |.|..||  .|.|......:|       ||    |:.|..:     |..|.|::      :..::
 Worm     4 IECEICN--EDFSSATDENIP-------RI----LRCGHTI-----CHGCAEKL------LQNSM 44

  Fly   491 NLCTLCKEAHERQRSTASHRMRSILELRRARKQKQQQMGLGDSSKLVLRCGIHT-NFE----LKA 550
            .||..|:||..........:..::|:.....|.:.::....||..   :|..|. ||.    ::.
 Worm    45 ILCPFCREATNVSTVKDLQKNFALLQAVEHAKTRTEEKDPIDSPP---KCASHQYNFAEFVCIEP 106

  Fly   551 FCTNCRQLACTDCLVI-LHKGHRHETISRAIGHQGKLLKEATDQTRPLCQYAEHSIERLNAIARG 614
            .|::..:|.|..|... .|.||....:........:.|.....::..|....:.:||::.. |:.
 Worm   107 TCSSSDKLMCRTCEEFGAHAGHNRGLLQSEAAKLRQFLSGKLSRSEDLASKIDANIEKIGT-AQL 170

  Fly   615 INDRCDDIQTQVER---------YMQQYMDALTVHRKTLLQQISRARESKVEVV---LKQQLDLE 667
            .|  .||.:...|:         .:::.:|||.......||.|:.......:::   |.:.|:.:
 Worm   171 TN--LDDGEVFQEKKVSIIAFYASIRETLDALENDALATLQNIAETNFFTNDLLIAELSESLNRQ 233

  Fly   668 KRTQQAMDA-VRFSQ-ELCEIGADVEILSYVTILLRRLEYCQQFKPPVDPKISDSLHFLPKI 727
            ||....:.. ::.|. :|..:.:.:|:.|       ..|...:| ..|:|::.|:....|::
 Worm   234 KRKSAELKLFMKMSNADLLAVNSALEVSS-------ENELWTEF-ADVEPEVFDAALIFPEM 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8419NP_609193.1 RING 308..>334 CDD:214546
zf-B_box 537..576 CDD:279037 11/44 (25%)
iSH2_PI3K_IA_R 583..703 CDD:304922 23/133 (17%)
Filamin 748..846 CDD:279024
IG_FLMN 751..849 CDD:214720
F43C11.8NP_494244.2 RING_Ubox 5..52 CDD:388418 16/70 (23%)
modified RING-HC finger (C3HC3D-type) 6..50 CDD:319361 15/67 (22%)
Bbox2_TRIM23_C-IX_rpt2 88..137 CDD:380832 11/51 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.