DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8419 and si:dkey-106l3.6

DIOPT Version :9

Sequence 1:	NP_609193.1	Gene:	CG8419 / 34118	FlyBaseID:	FBgn0031999	Length:	921	Species:	Drosophila melanogaster
Sequence 2:	XP_003199368.2	Gene:	si:dkey-106l3.6 / 100526811	ZFINID:	ZDB-GENE-091204-159	Length:	261	Species:	Danio rerio

Alignment Length:	112	Identity:	28/112 - (25%)
Similarity:	34/112 - (30%)	Gaps:	47/112 - (41%)

- Green bases have known domain annotations that are detailed below.

  Fly   257 PRPEVFDAPSPLTRSPS--------------------------------RSPGISPPVSPSPSIT 289
            |||.| ..|:|:.|..:                                ||...|...|.:.|..
Zfish    74 PRPLV-SPPAPVLRREASYLAQRKASTADICYHQFHYKMDDVIVNQYVLRSSSTSSSSSSTSSGP 137

  Fly   290 LRPSTPPENTVIFTDDLKCGICLDVYT----DPRTLHCLHSFCLQCL 332
            :.|..|          |.|..|...|.    .||.|.||||.|.:||
Zfish   138 VMPCEP----------LDCPTCGHTYNFAGKRPRILSCLHSVCEECL 174

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8419	NP_609193.1	RING	308..>334	CDD:214546	13/29 (45%)
		zf-B_box	537..576	CDD:279037
		iSH2_PI3K_IA_R	583..703	CDD:304922
		Filamin	748..846	CDD:279024
		IG_FLMN	751..849	CDD:214720
si:dkey-106l3.6	XP_003199368.2	RING-HC_RNF208	143..196	CDD:319473	15/42 (36%)
si:dkey-106l3.6	XP_003199368.2	RING-HC finger (C3HC4-type)	146..192	CDD:319473	13/29 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D489543at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010