powered by:
Protein Alignment CG8419 and rnf152
DIOPT Version :9
Sequence 1: | NP_609193.1 |
Gene: | CG8419 / 34118 |
FlyBaseID: | FBgn0031999 |
Length: | 921 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004915369.1 |
Gene: | rnf152 / 100486837 |
XenbaseID: | XB-GENE-1001845 |
Length: | 203 |
Species: | Xenopus tropicalis |
Alignment Length: | 59 |
Identity: | 17/59 - (28%) |
Similarity: | 26/59 - (44%) |
Gaps: | 8/59 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 306 LKCGICLDVYTD---PRTLHCLHSFCLQCLVSENFKDESL---WDQDQARSEEPSNYSL 358
|:|.||.:.|:. |:.|.|.|:.|..||.......:.| |.:...:. |..||:
Frog 10 LECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRASQKDLRCPWCRGVTKL--PPGYSV 66
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D489543at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.