DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP5 and AT1G53710

DIOPT Version :9

Sequence 1:NP_609191.1 Gene:PGAP5 / 34116 FlyBaseID:FBgn0031997 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_175775.2 Gene:AT1G53710 / 841809 AraportID:AT1G53710 Length:528 Species:Arabidopsis thaliana


Alignment Length:396 Identity:99/396 - (25%)
Similarity:168/396 - (42%) Gaps:92/396 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVLC-----ALIFCEYVADFV-VLQKCKWPEIKRKKYVDDP--LRAMILADPHLLGPHRGHWLDK 66
            :.||     .:::.|..|.:| .|..|.||..|......|.  .:..|:.||.|        :||
plant     9 VALCLIWAATILYGEMFAFWVPSLFTCSWPHHKSDGVESDGNFTKVAIVTDPQL--------MDK 65

  Fly    67 ----------------LYREWHMTRAFQAASRLFQPDVVFVLGDLFDEGDMVSDKQFQEYVWRYL 115
                            .|.:.:|.|:|..:...|:||||..|||.||.|..:|::::||.:.|..
plant    66 TSFRLSSKTLALELAQFYTDINMRRSFFRSVLPFKPDVVLFLGDYFDGGPFLSEEEWQESLNRLK 130

  Fly   116 KMFHLPP-----GIPLISVAGNHDVGF----HYKMHPFFMSRFESYLNNSSVNLYTIKQIHFVVI 171
            .:|.|..     .||...:.||||:|:    .:|..  .:.|:|......: ..:.|..:.|:.|
plant   131 HVFGLNSEGRVGDIPTFYIPGNHDIGYSRVASHKQG--VIDRYEKVFGVRN-RRFMIGNVEFISI 192

  Fly   172 NSMAMEGDGCM-FCTQAEDQLKNISRTLYCMKYPLEAECARTRRHPYSQPILLQHFPTYRISDTM 235
            ::.|::|:... ..::....::|:|              ...:.||   .:||.|.|.||...|.
plant   193 DAQAIDGNSKKDLASEVWKFVQNVS--------------TDAQSHP---RVLLTHIPLYRPDQTP 240

  Fly   236 CEEHDAPYIEAFRERF-------------HVLSKDATDMLGELLKPRLAFAGHSHHFC---HSVN 284
            |..|....:  ..:||             ::..:.:|.:| ||:||.|..:||.|..|   |...
plant   241 CGPHRGSSV--IDQRFWRHSQDQEVIYQNYITPESSTKLL-ELIKPILVLSGHDHDQCTVIHKSK 302

  Fly   285 RLGIDEYTVASFSW-RNKVNPSFMLATI---------TPDDYVVSKCKMLPQQ-FVFNSYLSAGI 338
            ...:.|:|:.:.|| :..::|||||.::         .||..:.::...||.| |::..|||..:
plant   303 AGSVTEHTLGTVSWQQGNIHPSFMLLSVPKAFHRNSSDPDKMLHTQLCFLPSQLFIYMWYLSLFV 367

  Fly   339 LCLIVI 344
            :.|:.:
plant   368 MSLLAL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP5NP_609191.1 Metallophos 45..279 CDD:278574 67/272 (25%)
MPP_MPPE1 48..301 CDD:277372 73/295 (25%)
AT1G53710NP_175775.2 MPP_Cdc1_like 55..319 CDD:277330 73/294 (25%)
Metallophos 100..292 CDD:278574 55/214 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3383
eggNOG 1 0.900 - - E1_KOG3662
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I2195
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094620at2759
OrthoFinder 1 1.000 - - FOG0003247
OrthoInspector 1 1.000 - - oto4200
orthoMCL 1 0.900 - - OOG6_104282
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.