DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP5 and Mppe

DIOPT Version :9

Sequence 1:NP_609191.1 Gene:PGAP5 / 34116 FlyBaseID:FBgn0031997 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001286327.1 Gene:Mppe / 36285 FlyBaseID:FBgn0259985 Length:366 Species:Drosophila melanogaster


Alignment Length:399 Identity:78/399 - (19%)
Similarity:147/399 - (36%) Gaps:124/399 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVIVLCALIFCEYVADFVV--LQKCKWPEIKRKKYVDDPLRAMILADPHLLG---PHRGHW-LDK 66
            ||.:...|:|..   :|:|  :.:..|..|..|  :|:..|.:::|||.:||   ....|. |.:
  Fly    17 FVALTLLLVFFN---EFIVYYMAQSSWQPIDCK--LDNCTRLLLIADPQILGNSYDRSSHSPLAR 76

  Fly    67 LYREWHMTRAFQAASRLFQPDVVFVLGDLFDEGDMVSDKQFQEYVWRYLKMFH---------LPP 122
            ...:.::.:.|:.|....||.::..||||.|||::.:.:::::||.|:.:::.         :..
  Fly    77 YDSDRYLAKTFERALAFTQPHIIVFLGDLLDEGNIATAQEYKQYVQRFRRIYQNKNYKKFRMISA 141

  Fly   123 GIPLISVAGNHDVGFHYKMHPFFMSRFESYLNNS----------SVNLYTI-KQIHFVVINSMAM 176
            ....:.|.|::|:|          .....|::||          |.:|:.. .::.|..||.|.:
  Fly   142 FFQRVHVPGDNDIG----------GENGDYISNSNQRRFENEFMSEDLFDYDNRLRFFKINRMLL 196

  Fly   177 EGDGCMFCTQAEDQLKNISRTLYCMKYPLEAECARTRRHPYSQPILLQHFPTYR--ISDTMCEEH 239
            :             ..|..|         :....|.|......|:|:...|..|  |||      
  Fly   197 D-------------FSNPDR---------DNNADRLRIGVSHAPLLIGGGPLLRAIISD------ 233

  Fly   240 DAPYIEAFRERFHVLSKDATDMLGELLKPRLAFAGHSHH---FCH-SVNRLGIDEYTVASFSWR- 299
                                      |.|.:.|:||.|.   |.: |...:...|.:|..|..: 
  Fly   234 --------------------------LDPHIIFSGHWHESRIFIYPSTKVINFYENSVRHFDLKA 272

  Fly   300 -NKVNPSFMLATITPDDYVVSKCKM------------------LPQQFV-FNSYLSAG--ILCLI 342
             .:...|::...:....|.:.|.|:                  .|.:|: ..:|:..|  ::|..
  Fly   273 LKEQEHSYLEIMVPTCSYRMGKSKIGLGYAVLENYNLSYTVLWQPNRFILLFTYVFWGLFVVCGF 337

  Fly   343 VIGFQLRKC 351
            |:...:.:|
  Fly   338 VVFKMMTRC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP5NP_609191.1 Metallophos 45..279 CDD:278574 52/262 (20%)
MPP_MPPE1 48..301 CDD:277372 56/284 (20%)
MppeNP_001286327.1 Metallophos 52..246 CDD:278574 51/257 (20%)
MPP_Cdc1_like_1 54..293 CDD:277373 58/302 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448307
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3662
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3042
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094620at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1923
SonicParanoid 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.