DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP5 and SPAC630.12

DIOPT Version :9

Sequence 1:NP_609191.1 Gene:PGAP5 / 34116 FlyBaseID:FBgn0031997 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_592908.1 Gene:SPAC630.12 / 2543429 PomBaseID:SPAC630.12 Length:422 Species:Schizosaccharomyces pombe


Alignment Length:385 Identity:90/385 - (23%)
Similarity:152/385 - (39%) Gaps:94/385 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVIVLCALIFCEYVADFVVL------QKCKWPEIKRKKYVDDPLRAMILADPHLLG--------P 58
            |::::.   ||.||.....:      :||.|...::.:...:|:|..::|||.|:.        |
pombe     6 FLVIIA---FCFYVLYLEKIIHTRPHKKCDWRSWEQWESTGNPVRIALVADPQLVDDLTYDYPRP 67

  Fly    59 HRG--HWLDK--LYREWHMTRAFQAASRLFQPDVVFVLGDLFDEGDMVSDKQFQEYVWRYLKMFH 119
            ..|  .|:..  |.|.|....      :..:||:.|::|||.|.|...:.::|::..:|.:.:  
pombe    68 LIGIVKWISDQFLRRHWRYLH------KSLKPDITFIMGDLMDTGREFATEEFKKDYFRMMNV-- 124

  Fly   120 LPPGI--PLISVAGNHDVGFHYKMHPFFMSRFESYLNNSS----VNLYTIKQIHFVVINSMAMEG 178
            |.|..  .|....||||:||........:.||||....:|    |..:|:     |::       
pombe   125 LDPKFTNKLEIYPGNHDIGFGNHAIVKDIQRFESLFGPTSRSIDVGNHTL-----VIV------- 177

  Fly   179 DGCMFCTQAEDQLKNISRTLYCMKYPLEAECARTRRHPYSQPILLQHFPTYRISDTMCEEHDAPY 243
            ||.........|:...:|. :...:....:.:|.|       |||.|.|.:|.:...|.|     
pombe   178 DGIRLSNNVNPQVYQPARD-FLKSFETNKDNSRPR-------ILLSHVPLFRPAINSCGE----- 229

  Fly   244 IEAFRERFHV------------LSKDATDMLGELLKPRLAFAGHSHHFCHSVNRLGID------- 289
               .||:..|            |..:.::.:.:.::|..||||..|.:|..|:...:|       
pombe   230 ---LREKDDVIKYGLGYQYQNLLLPELSESILKAVEPIAAFAGDDHDYCEVVHNYQVDTREAATT 291

  Fly   290 EYTVASFSWRNKV-NPSFMLATIT-PDD---------YVVSKCKMLPQQFVFNSYLSAGI 338
            ||.|.:||..:.: .|.:.|.::. |.|         |....| :||.|.....:..|.|
pombe   292 EYNVKAFSMTSGILYPGYQLLSLNYPYDNPKADQKSSYQTKLC-ILPNQIQIYVWYGASI 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP5NP_609191.1 Metallophos 45..279 CDD:278574 62/263 (24%)
MPP_MPPE1 48..301 CDD:277372 69/289 (24%)
SPAC630.12NP_592908.1 MPP_Cdc1 49..303 CDD:277370 69/289 (24%)
Metallophos 80..241 CDD:278574 47/196 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I3308
eggNOG 1 0.900 - - E1_KOG3662
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1901
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003247
OrthoInspector 1 1.000 - - oto102016
orthoMCL 1 0.900 - - OOG6_104282
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1923
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.