DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8460 and Cht7

DIOPT Version :10

Sequence 1:NP_609190.2 Gene:CG8460 / 34115 FlyBaseID:FBgn0031996 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_647768.3 Gene:Cht7 / 38370 FlyBaseID:FBgn0035398 Length:1013 Species:Drosophila melanogaster


Alignment Length:405 Identity:87/405 - (21%)
Similarity:147/405 - (36%) Gaps:113/405 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLRVALLLLLLTTVRGTLAPDSHKSKSKTKESALRG----GPQDQDVFDLGLVSPEPLAK----D 64
            |||:|.::.||..:   |:|.:..:::||:....|.    .....::.:....:..|.|:    .
  Fly     6 LLRIAFVICLLIVL---LSPSADSAQTKTRRRLRRPTTSVSSSRSNLIESKKSTEAPEAEKRIDQ 67

  Fly    65 IVSNHRGYFKETGLR---------------RFNGTTL----------------------GYVTPW 92
            |.|......:.|.||               ...||.|                      .|.|.|
  Fly    68 ITSATTTSARRTRLRSKAKLGAAAAGGAAVAAGGTALVASGSSLKGKKTKVDDGTPKIVCYYTNW 132

  Fly    93 NSHGYDVAKIFAKKFDIISPVWLQIVKQGDRYAVAGTHDIDA-GWLTDVRRKGKQVHNQRTVKV- 155
            :.:...:.|...:                |..|...||.|.| |||...:....:.:::....| 
  Fly   133 SQYRVKIGKFVPE----------------DIPADLCTHIIFAFGWLKKNKLSSYESNDETKDNVP 181

  Fly   156 --FPRFIFDHFTDRDIKLLLS--------------DAQERTKVNDV--LIKCCKDNGFDGLVLEV 202
              :.|.:.....:..:|:||:              .:...|:...|  .|...:..|||||.:: 
  Fly   182 GLYERMMTLKKANPKLKILLALGGWSFGTQKFKDMSSTRYTRQTFVYSAIPFLRKRGFDGLDMD- 245

  Fly   203 WSQLAGRIDDKILYTLVLQ--------MAKELQKQQLRLILVIP--PFRKETGHLFGEKHMDKLF 257
            |....|. |||..:.|:|:        .|:||:|.:|.|...:|  |     .::.|...:..:.
  Fly   246 WEYPKGS-DDKKNFVLLLKELREAFEAEAQELKKPRLLLSAAVPVGP-----DNIRGGYDVPAIA 304

  Fly   258 KHIYAFSLMTYDFSS--VQRPGANAPLYFVRKAVE---TIAPEGCAD----MTAKRAKILLGLNM 313
            .::...:||.|||..  .:..|.|||||......|   .::.:..|.    |.|.:.|:::|:..
  Fly   305 SYLDFINLMAYDFHGKWERETGHNAPLYAPSTDSEWRKQLSVDNAASLWVKMGAPKEKLVIGMPT 369

  Fly   314 YGNDYT---PDGGGP 325
            ||..:|   ||..||
  Fly   370 YGRSFTLANPDKHGP 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8460NP_609190.2 GH18_SI-CLP 81..402 CDD:119355 69/309 (22%)
Cht7NP_647768.3 GH18_chitolectin_chitotriosidase 125..491 CDD:119351 66/283 (23%)
GH18_chitolectin_chitotriosidase 560..919 CDD:119351
CBM_14 951..1005 CDD:426342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.