DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8460 and Cda5

DIOPT Version :10

Sequence 1:NP_609190.2 Gene:CG8460 / 34115 FlyBaseID:FBgn0031996 Length:402 Species:Drosophila melanogaster
Sequence 2:NP_722590.2 Gene:Cda5 / 33158 FlyBaseID:FBgn0051973 Length:1998 Species:Drosophila melanogaster


Alignment Length:95 Identity:19/95 - (20%)
Similarity:33/95 - (34%) Gaps:24/95 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 TTVRGTLAPDSHKSKSKTKESALRGGPQDQDVFDLGLVSPEPLAKDIVSNHRGYFKETGLRRFNG 83
            |....|:.|..|:|..:..::.::..|......   .|||.|:.                     
  Fly   151 TQKTATVPPQYHRSPPQVIQAQVQNIPPPPPEL---RVSPNPVI--------------------- 191

  Fly    84 TTLGYVTPWNSHGYDVAKIFAKKFDIISPV 113
            |:.|...|......|:||::|...:.:.||
  Fly   192 TSRGQPKPLIDSQEDIAKLYADAQESLPPV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8460NP_609190.2 GH18_SI-CLP 81..402 CDD:119355 9/33 (27%)
Cda5NP_722590.2 CBM_14 58..106 CDD:426342
CE4_CDA_like_2 1664..1926 CDD:200597
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.