powered by:
Protein Alignment Acbp1 and ACBD5
DIOPT Version :9
Sequence 1: | NP_001285744.1 |
Gene: | Acbp1 / 34111 |
FlyBaseID: | FBgn0031992 |
Length: | 90 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016872373.1 |
Gene: | ACBD5 / 91452 |
HGNCID: | 23338 |
Length: | 609 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 28/69 - (40%) |
Similarity: | 43/69 - (62%) |
Gaps: | 0/69 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 KNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTDAQAAYITKV 79
||.:..|.:..:|:.||.|||||.|.|...:|||.|..|:.||:||::...|:..:|..||:.::
Human 123 KNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMIAYVEEM 187
Fly 80 KALI 83
|.:|
Human 188 KKII 191
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Acbp1 | NP_001285744.1 |
ACBP |
5..87 |
CDD:238248 |
28/69 (41%) |
ACBD5 | XP_016872373.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG4281 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.