DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and ACBP1

DIOPT Version :10

Sequence 1:NP_609187.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_200159.1 Gene:ACBP1 / 835428 AraportID:AT5G53470 Length:338 Species:Arabidopsis thaliana


Alignment Length:63 Identity:26/63 - (41%)
Similarity:32/63 - (50%) Gaps:1/63 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NDL-LELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTDAQAAYITKVKALIAA 85
            |:| |:||.|||.||.|.|...:|..|....:|||:||.....|...:|...||..|..|..|
plant   119 NELQLQLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIDLVTQLYPA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_609187.1 ACBP 5..87 CDD:238248 26/63 (41%)
ACBP1NP_200159.1 ACBP 113..175 CDD:459982 23/55 (42%)
ANKYR <215..>323 CDD:440430
ANK repeat 221..248 CDD:293786
ANK repeat 250..281 CDD:293786
ANK repeat 283..314 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.