DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and Acbd7

DIOPT Version :9

Sequence 1:NP_001285744.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_084339.1 Gene:Acbd7 / 78245 MGIID:1925495 Length:88 Species:Mus musculus


Alignment Length:88 Identity:47/88 - (53%)
Similarity:60/88 - (68%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKG 65
            ||...:|:|||:||:.|.:.|.|.:|.|||.||||:.:||.|...|..||.||||||||||.:||
Mouse     1 MSLQADFDQAAQDVRKLKSRPEDEELKELYGLYKQSVIGDINIACPAMLDLKGKAKWEAWNLQKG 65

  Fly    66 MSNTDAQAAYITKVKALIAAVGL 88
            :|..||..|||:|.:.||...|:
Mouse    66 LSKEDAMCAYISKARELIEKYGI 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 44/81 (54%)
Acbd7NP_084339.1 ACBP 3..87 CDD:381873 44/83 (53%)
Acyl-CoA binding. /evidence=ECO:0000250 30..34 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849895
Domainoid 1 1.000 97 1.000 Domainoid score I7233
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H82242
Inparanoid 1 1.050 100 1.000 Inparanoid score I4976
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 1 1.000 - - otm42451
orthoMCL 1 0.900 - - OOG6_101568
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1384
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.