DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and acbd7

DIOPT Version :9

Sequence 1:NP_001285744.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001165067.1 Gene:acbd7 / 779685 XenbaseID:XB-GENE-5740466 Length:88 Species:Xenopus tropicalis


Alignment Length:88 Identity:50/88 - (56%)
Similarity:61/88 - (69%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKG 65
            ||...:|::||||||.|.|.|.|.:|.|||.||||:||||.|.|.||.||.|.||||:|||.:||
 Frog     1 MSPQADFDKAAEDVKKLKTRPTDEELKELYGLYKQSTVGDINIDCPGMLDLKAKAKWDAWNLKKG 65

  Fly    66 MSNTDAQAAYITKVKALIAAVGL 88
            :|..:|..|||:|...|:...||
 Frog    66 LSKEEAMHAYISKTNELVEKYGL 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 46/81 (57%)
acbd7NP_001165067.1 ACBP 4..87 CDD:238248 46/82 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H82242
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R12
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.