DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acbp1 and ACBD7

DIOPT Version :9

Sequence 1:NP_001285744.1 Gene:Acbp1 / 34111 FlyBaseID:FBgn0031992 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_001034933.1 Gene:ACBD7 / 414149 HGNCID:17715 Length:88 Species:Homo sapiens


Alignment Length:83 Identity:49/83 - (59%)
Similarity:59/83 - (71%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTD 70
            :|::|||||:.|...|.|.:|.|||.|||||.|||.|...||.||.||||||||||.:||:|..|
Human     6 DFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTED 70

  Fly    71 AQAAYITKVKALIAAVGL 88
            |.:|||:|.|.||...|:
Human    71 ATSAYISKAKELIEKYGI 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Acbp1NP_001285744.1 ACBP 5..87 CDD:238248 48/80 (60%)
ACBD7NP_001034933.1 ACBP 3..87 CDD:320831 48/80 (60%)
Acyl-CoA binding 30..34 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159523
Domainoid 1 1.000 102 1.000 Domainoid score I6842
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H82242
Inparanoid 1 1.050 104 1.000 Inparanoid score I4956
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63566
OrthoDB 1 1.010 - - D1588000at2759
OrthoFinder 1 1.000 - - FOG0001211
OrthoInspector 1 1.000 - - otm40381
orthoMCL 1 0.900 - - OOG6_101568
Panther 1 1.100 - - O PTHR23310
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R12
SonicParanoid 1 1.000 - - X1384
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.